"actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", "initiatorBinding" : true, //$('#lia-body').removeClass('lia-window-scroll'); { "displayStyle" : "horizontal", "event" : "removeMessageUserEmailSubscription", Portal zickt ebenso wie Aktualisierung des EPG.uswBeantrage Austausch des TV Centers und bitte reparieren, DankeServusHP Horn. { "context" : "envParam:quiltName", { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2058758 .lia-rating-control-passive', '#form_0'); '; { "context" : "envParam:quiltName,expandedQuiltName", var clickedDomElement = $(this); }, ;(function($){ }, { "eventActions" : [ "actions" : [ "disableLinks" : "false", ] "actions" : [ count++; { // Set start to true only if the first key in the sequence is pressed "disableKudosForAnonUser" : "false", ] { "quiltName" : "ForumMessage", "event" : "editProductMessage", "context" : "", }, ] { }, "context" : "", } ] "context" : "envParam:quiltName,message", "showCountOnly" : "false", Ich bin sehr zufrieden mit ihrem Service. "action" : "rerender" "truncateBody" : "true", ] "closeImageIconURL" : "https://forum.vodafone.de/skins/images/0F94F452D57A978C27D2D3E5195EDB37/responsive_peak/images/button_dialog_close.svg", "action" : "rerender" { { "event" : "MessagesWidgetEditAnswerForm", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { ;(function($) { // If watching, pay attention to key presses, looking for right sequence. "componentId" : "kudos.widget.button", }, if ( watching ) { ] } das „PVR IPTV Simple Client“ Addon. "action" : "rerender" ] } Portal zickt ebenso wie Aktualisierung des EPG.usw Beantrage Austausch des TV Centers und bitte reparieren, Danke Servus HP Horn . var ctaHTML = '. }); }, "actions" : [ "kudosLinksDisabled" : "false", }, ] }, { "eventActions" : [ ], "useSubjectIcons" : "true", "action" : "rerender" um es klar zu stellen--ich schaue über meine vu solo2 ausländische iptv sender,eingespielt über putty, alles läuft nur das ich kein epg habe. }, "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "", "accessibility" : false, "event" : "markAsSpamWithoutRedirect", "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } { "context" : "", "action" : "rerender" "actions" : [ "actions" : [ } { "showCountOnly" : "false", return; var watching = false; "action" : "rerender" "actions" : [ "event" : "AcceptSolutionAction", // Reset the conditions so that someone can do it all again. { "context" : "", { "event" : "ProductAnswer", "truncateBody" : "true", }); LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); count++; $('.community-menu').removeClass('active') }, Wenn Sie weitere Fragen haben, senden Sie eine Frage an unser technisches Support-Team. "initiatorBinding" : true, "action" : "pulsate" } "componentId" : "forums.widget.message-view", "context" : "", "revokeMode" : "true", "context" : "", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2058758,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. //$('#vodafone-community-header').css('display','block'); } } "context" : "", { "actions" : [ "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" "action" : "rerender" { Februar 2018 um 19:41 Hatte das gleiche Problem. } "context" : "envParam:quiltName,message", } { }, }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); { "closeImageIconURL" : "https://forum.vodafone.de/skins/images/0F94F452D57A978C27D2D3E5195EDB37/responsive_peak/images/button_dialog_close.svg", "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] ;(function($) { }, "event" : "QuickReply", "action" : "rerender" "disableKudosForAnonUser" : "false", { }, }, "actions" : [ Standardized Name defines channel's logo and EPG (if available), it also will be displayed in the app if the option Use custom channels' titles is turned off. { { "context" : "", "event" : "MessagesWidgetEditCommentForm", "action" : "rerender" } "event" : "ProductMessageEdit", "disallowZeroCount" : "false", Bist du sicher, dass du fortfahren möchtest? "actions" : [ "action" : "rerender" "context" : "", ], }); Dank IP-TV klappt das vielerorts übers Internet. "disallowZeroCount" : "false", "context" : "envParam:quiltName", } } } "useSimpleView" : "false", "action" : "rerender" "action" : "pulsate" "actions" : [ "actions" : [ "action" : "pulsate" } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "parameters" : { { LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); })(LITHIUM.jQuery); }, } { Bist du sicher, dass du fortfahren möchtest? /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2053068}},{"elementId":"link_15","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2058758}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2054408}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2058758}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2059717}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2501494}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2501131}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2497626}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2484681}},{"elementId":"link_40","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2505818}},{"elementId":"link_42","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506820}},{"elementId":"link_44","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506551}},{"elementId":"link_46","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506499}},{"elementId":"link_48","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506454}},{"elementId":"link_50","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506211}},{"elementId":"link_52","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506079}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506035}},{"elementId":"link_56","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2505943}},{"elementId":"link_58","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2505857}},{"elementId":"link_60","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2505752}}]); "revokeMode" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "entity" : "2059717", }, } }, ] "actions" : [ "action" : "rerender" "initiatorBinding" : true, phunkyfish. "parameters" : { { { { "action" : "rerender" "event" : "ProductMessageEdit", "action" : "rerender" } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); $(document).ready(function() { }, "event" : "markAsSpamWithoutRedirect", } Gustav Fröhlich Hamburg, Deutschland. { "context" : "envParam:quiltName", } { }); { return; 10MB), a smart tv mit iptv app or a iptv receiver. "event" : "MessagesWidgetAnswerForm", "message" : "2054408", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.AjaxSupport.ComponentEvents.set({ ] }); }, "disableLabelLinks" : "false", }, "event" : "AcceptSolutionAction", "action" : "rerender" }, ] Bist du sicher, dass du fortfahren möchtest? //}); "disableKudosForAnonUser" : "false", } { { "includeRepliesModerationState" : "false", else { }); LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_2cd3e022c9658c","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/StoerungsmeldungenInternetTVTelefon/thread-id/46276&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "action" : "rerender" { "event" : "expandMessage", { } var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "context" : "envParam:quiltName,message", $('li.close-on-click').on('click',resetMenu); "actions" : [ "context" : "lia-deleted-state", "actions" : [ "action" : "rerender" "useTruncatedSubject" : "true", ] "event" : "removeThreadUserEmailSubscription", "actions" : [ Professional. "context" : "", "context" : "envParam:feedbackData", }, } "event" : "RevokeSolutionAction", "context" : "", "event" : "ProductMessageEdit", }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "displaySubject" : "true", "context" : "lia-deleted-state", "selector" : "#messageview_0", "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'wyJr9roVzwZKdEky9qBhOvMidZ8oz4IVypNIefAIe5I. "actions" : [ "context" : "", "disableLabelLinks" : "false", { { "event" : "MessagesWidgetMessageEdit", })(LITHIUM.jQuery); // Pull in global jQuery reference LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'EDz11XYPmtNCCGsJez-RF6mQ3TqPUxl2V_2CuwVMDfU. { "initiatorDataMatcher" : "data-lia-message-uid" "context" : "envParam:quiltName", } "action" : "rerender" "parameters" : { "useSubjectIcons" : "true", "actions" : [ "event" : "addMessageUserEmailSubscription", "actions" : [ { { ] "action" : "pulsate" "actions" : [ count = 0; LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); ] { { ] "context" : "", Es gibt keine HD Sender wie Prosieben HD sondern nur Prosieben. "action" : "rerender" { "action" : "rerender" { "selector" : "#messageview_2", { "linkDisabled" : "false" "forceSearchRequestParameterForBlurbBuilder" : "false", ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" }; } } "event" : "ProductMessageEdit", { "useCountToKudo" : "false", "useSimpleView" : "false", Ich habe folgendes Problem: ich kann mit meinem TV Center 2000 die öffentlich rechtlichen Sender empfangen, aber keine payTV-Sender (zB RTL Crime, SyFy, 13th Street) mehr, obwohl mein Abo diese umfasst. "context" : "envParam:quiltName", if ( neededkeys[count] == key ) { LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); { }, ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_2cd3e022c9658c_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/StoerungsmeldungenInternetTVTelefon/thread-id/46276&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); LITHIUM.Dialog.options['1298932233'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "event" : "approveMessage", "actions" : [ watching = false; "actions" : [ }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "pulsate" "forceSearchRequestParameterForBlurbBuilder" : "false", }, 13.09.2017 - Struktur-Update / Neue Sender / Entertain IPTV Ein Update der gesamten Dateistruktur wurde aufgrund des nun deutlich größeren Inhalts und der daraus resultierenden Unübersichtlichkeit der Kanäle nötig. $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { }, "action" : "rerender" ', 'ajax'); // We made it! LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "rerender" "truncateBody" : "true", "context" : "", } LITHIUM.Dialog.options['388091963'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "action" : "rerender" "includeRepliesModerationState" : "false", }, { "actions" : [ }, "event" : "markAsSpamWithoutRedirect", "event" : "ProductMessageEdit", Für digitales Fernsehen braucht man weder Satellit noch Kabel oder DVB-T. { "selector" : "#kudosButtonV2_2", { Mit Zattoo streamst du alle top TV-Sender online. watching = false; "action" : "pulsate" } LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { }, }, "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, "useCountToKudo" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); ] }, "action" : "rerender" "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" }, } LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "context" : "", { "event" : "MessagesWidgetAnswerForm", ] "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", "actions" : [ "event" : "approveMessage", }, } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] element.removeClass('active'); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/StoerungsmeldungenInternetTVTelefon/thread-id/46276","ajaxErrorEventName":"LITHIUM:ajaxError","token":"0VuHsdtNJr7LjkwJkYQA1rPuvCOcVvEGenZSnRoILGc. Bist du sicher, dass du fortfahren möchtest? $(document).keydown(function(e) { "context" : "", }, "componentId" : "kudos.widget.button", }, DO NOT uninstall it, if you want to keep the already installed application working on your TV.. { "actions" : [ "kudosable" : "true", LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } "actions" : [ { } }, { } "closeImageIconURL" : "https://forum.vodafone.de/skins/images/0F94F452D57A978C27D2D3E5195EDB37/responsive_peak/images/button_dialog_close.svg", "actions" : [ "event" : "MessagesWidgetEditAction", "context" : "lia-deleted-state", "componentId" : "forums.widget.message-view", "truncateBody" : "true", "action" : "rerender" { "actions" : [ "action" : "rerender" { "action" : "rerender" } "action" : "rerender" } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "MessagesWidgetMessageEdit", "event" : "MessagesWidgetEditAnswerForm", ] "context" : "envParam:entity", "action" : "rerender" ctaHTML += "Lösung noch nicht gefunden? "context" : "", 0. Sie können auch versuchen, den Fernseher auf die Werkseinstellungen zurückzusetzen. $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ "context" : "envParam:selectedMessage", "kudosable" : "true", }, "action" : "rerender" "context" : "", ] Smart IPTV on Samsung Smart TV Samsung has suspended the app from the Samsung Apps Store without notice. // We're good so far. "action" : "rerender" "event" : "ProductAnswerComment", { "context" : "envParam:quiltName", watching = false; LITHIUM.Dialog.options['388091963'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "messageViewOptions" : "1111110111111111111110111110100101001101" ] "actions" : [ ] ] "event" : "ProductAnswer", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2059717,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "addThreadUserEmailSubscription", "event" : "ProductAnswerComment", "}); "actions" : [ { "event" : "ProductAnswerComment", Mehr Infos. "context" : "", "kudosable" : "true", "activecastFullscreen" : false, }, { if ( key == neededkeys[0] ) { $('#vodafone-community-header .lia-search-toggle').click(function() { { { } "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); { $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; ] { "context" : "lia-deleted-state", }, ], "context" : "",